toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Beaver hunt (medium) by KI-Vossy tagged beaver,beavers,biber,britain,norfolk,england,wildlife,camera,kamera,pensthorpe,rodent,trunks,lodge,nigel,farage,vermin,beaver,beavers,biber,britain,norfolk,england,wildlife,camera,kamera,pensthorpe,rodent,trunks,lodge,nigel,farage,vermin

Beaver hunt

#475199 / vista 990 veces
KI-Vossy de KI-Vossy
on 07 07+00:00 December 07+00:00 2025
rating-star 4
Applause
favorite
Favorito
report spam
Denunciar

For the first time since beavers were eradicated in Great Britain at the beginning of the 16th century, a wild beaver has been spotted in Norfolk. A wildlife camera at Pensthorpe Natural Park filmed the rodent a few weeks ago dragging tree trunks and building a beaver lodge.

This will certainly not please everyone.

Naturaleza »  Medio Ambiente  Evolución  Animales  Animales amenazados  Plantas  la Tierra  Mares & Océanos  Descubrimientos  Protección de la Naturaleza  Destrucción Ecológica  Humano

beaverbeaversbiberbritainnorfolkenglandwildlifecamerakamerapensthorperodenttrunkslodgenigelfarageverminbeaverbeaversbiberbritainnorfolkenglandwildlifecamerakamerapensthorperodenttrunkslodgenigelfaragevermin

Collections

(1)
Global warming

comentarios (2)

 
KI-Vossy
Member
MorituruS wrote:
It has long been clear that beavers are not vermins.
yes, but not for nigel!

KI-Vossy, on 07 07+00:00 December 07+00:00 2025  reportar  contestar applause 0

 
MorituruS
Member
It has long been clear that beavers are not vermins. The real vermins are others.

MorituruS, on 07 07+00:00 December 07+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Ein Merzlein steht im Walde (small) by KI-Vossy tagged cop30,merz,stadtbild,klimakonferenz,klima,klimawandel,brasilien,belen,cdu,kanzler,bundeskanzler,regierung,bundesregierung,wald,regenwald,arnsberger,suaerland,nrw
Ein Merzlein steht im Walde
Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: Basta! (small) by KI-Vossy tagged italien,meloni,politik,albanien,flüchtlinge,eu,rom,mittelmeer,flüchtlingspolitik,abschieben,abschiebung,internieren,internierung,gericht,dekret,herkunft,herkunftsländer,flüchtlingslager,lager,basta
Basta!
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.