toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Wahlplakathänger (medium) by RABE tagged wahl,wahlkampf,landtagswahlen,wahlplakate,wähler,wahlkämpfer,sicherheit,beschimpfung,wahlredner,wahlkampfveranstaltung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,kommunalwahl,europawahl,wahlurne,schlägertrupp,gewalt,arzt,patient,arztpraxis,sprechzimmer,wartezimmer,verband,gipsbein,gipsarm,verletzung,veilchen,blut,wahl,wahlkampf,landtagswahlen,wahlplakate,wähler,wahlkämpfer,sicherheit,beschimpfung,wahlredner,wahlkampfveranstaltung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,kommunalwahl,europawahl,wahlurne,schlägertrupp,gewalt,arzt,patient,arztpraxis,sprechzimmer,wartezimmer,verband,gipsbein,gipsarm,verletzung,veilchen,blut

Wahlplakathänger

#443353 / vista 1506 veces
RABE de RABE
on 05 05+00:00 May 05+00:00 2024
rating-star 3
Applause
favorite
Favorito
report spam
Denunciar

Ohne Worte

Política »  Nacional  Elecciones  Impuestos  Terrorismo  Finanzas  Pensión  Economía & Dinero  Tecnología  Medio Ambiente  Salud  Familia & Juventud  Educación  Confederaciones  Trabajos & Social  Inmigración  Fraude & Corrupción  Histórico  Otros  Conflictos & Guerra  Políticos  Partidos  Democracia

wahlwahlkampflandtagswahlenwahlplakatewählerwahlkämpfersicherheitbeschimpfungwahlrednerwahlkampfveranstaltungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonkommunalwahleuropawahlwahlurneschlägertruppgewaltarztpatientarztpraxissprechzimmerwartezimmerverbandgipsbeingipsarmverletzungveilchenblutwahlwahlkampflandtagswahlenwahlplakatewählerwahlkämpfersicherheitbeschimpfungwahlrednerwahlkampfveranstaltungraberalfböhmecartoonkarikaturpressezeichnungfarbcartoontagescartoonkommunalwahleuropawahlwahlurneschlägertruppgewaltarztpatientarztpraxissprechzimmerwartezimmerverbandgipsbeingipsarmverletzungveilchenblut

comentarios (2)

 
Erl
Member
Betonung auf Kampf.

Erl, on 05 05+00:00 May 05+00:00 2024  reportar  contestar applause 0

 
Harm Bengen
Member
in jedem fall eine verbandsklage anstrengen!

Harm Bengen, on 05 05+00:00 May 05+00:00 2024  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de RABE


Cartoon: Trump hängt (small) by RABE tagged merz,union,kanzler,fritze,koalition,spd,klingbeil,bundesregierung,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,trump,putin,krisen,tv,nachrichten,waschmaschine,donald,präsident,usa,damokles,damoklesschwert,all,weltall,erde,erkugel,sicherhetsrisiko,erdkugel,eu,weltherrschaft
Trump hängt
Cartoon: Attraktive Bahn (small) by RABE tagged db,dgl,tarif,tarifstreit,tarifverhandlungen,weselsky,bahnchefs,lohnforderungen,streik,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,fabcartoon,tagescartoon,attraktivität,modernisierung,bahnpreiserhöhunh,fahrpreiserhöhung,bahnbeauftragter,investitionen,finanzierung
Attraktive Bahn
Cartoon: Kochsalz für alle (small) by RABE tagged ampel,ampelregierung,rot,grün,gelb,fdp,spd,grüne,rabe,ralf,böhme,cartoon,karikatur,pressezeichnung,farbcartoon,tagescartoon,inflation,einkommen,rente,rentenpaket,bruch,streit,neuwahlen,karl,lauterbach,kochsalz,kochsalzlösung,engpass,nobelpreis,chemie,schweden,akademie,stockholm,protein
Kochsalz für alle
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.