toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Pocket war (medium) by KI-Vossy tagged ukraine,war,russia,fighter,rafale,air,force,zelensky,paris,france,macron,leyen,eu,europäische,union,europe,european,memorandum,purchase,jet,jets,kampfjet,kampsjets,russland,putin,luftwaffe,aufrüstung,aufrüsten,selenskyi,frankreich,kampfflugzeug,kampfflugzeuge,ukraine,war,russia,fighter,rafale,air,force,zelensky,paris,france,macron,leyen,eu,europäische,union,europe,european,memorandum,purchase,jet,jets,kampfjet,kampsjets,russland,putin,luftwaffe,aufrüstung,aufrüsten,selenskyi,frankreich,kampfflugzeug,kampfflugzeuge

Pocket war

#474119 / vista 679 veces
KI-Vossy de KI-Vossy
on 18 18+00:00 November 18+00:00 2025
rating-star 1
Applause
favorite
Favorito
report spam
Denunciar

Ukraine wants to order 100 French Rafale fighter jets to upgrade its air force. This was announced by President Volodymyr Zelensky during his visit to France. According to the French presidential office, he and French President Emmanuel Macron signed a memorandum of understanding on the purchase of the fighter jets. No details on the purchase price or financing were initially disclosed.

Die Ukraine möchte 100 französische Kampfjets vom Typ "Rafale" ordern, um ihre Luftwaffe aufzurüsten. Das kündigte Präsident Wolodymyr Selenskyj während seines Besuchs in Frankreich an. Laut französischem Präsidialamt unterzeichneten er und der französische Präsident Emmanuel Macron eine Absichtserklärung zum Kauf der Kampfflugzeuge. Über Kaufpreis und Finanzierung wurde zunächst nichts bekannt.

Política »  Internacional  Ejército & Seguridad  Terrorismo  Economía & Dinero  Tecnología  Confederaciones  Fraude & Corrupción  Histórico  Otros  Conflictos & Guerra  Políticos  Partidos  Democracia

ukrainewarrussiafighterrafaleairforcezelenskyparisfrancemacronleyeneueuropäischeunioneuropeeuropeanmemorandumpurchasejetjetskampfjetkampsjetsrusslandputinluftwaffeaufrüstungaufrüstenselenskyifrankreichkampfflugzeugkampfflugzeugeukrainewarrussiafighterrafaleairforcezelenskyparisfrancemacronleyeneueuropäischeunioneuropeeuropeanmemorandumpurchasejetjetskampfjetkampsjetsrusslandputinluftwaffeaufrüstungaufrüstenselenskyifrankreichkampfflugzeugkampfflugzeuge

Collections

(1)
Political Cartoons - International!

comentarios (1)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, on 18 18+00:00 November 18+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: New York (small) by KI-Vossy tagged usa,new,york,democrat,democrats,republican,republicans,mamdani,zohran,mayor,us,president,donald,trump,potus,darkness,election,elections,light,triumph,demokrat,demokraten,republikaner,jungle,albtraum,cuomo,candidate,big,apple
New York
Cartoon: Yes it is .... (small) by KI-Vossy tagged halloween,pumpkin,pumpkins,wien,der,dritte,mann,film,celebration,celebrations,kürbis,kürbisse,prater,riesenrad,austria,österreich,vienna,night,nacht,kalauer
Yes it is ....
Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.