toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Lack of Intelligence (medium) by KI-Vossy tagged usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure,immune,potus,usa,trump,intelligece,health,vaccine,marks,fda,drugs,disinformation,lies,kennedy,resistance,media,pressure

Lack of Intelligence

#461197 / vista 1531 veces
KI-Vossy de KI-Vossy
on 29 29+00:00 March 29+00:00 2025
rating-star 3
Applause
favorite
Favorito
report spam
Denunciar

The U.S. government's top vaccine expert, Peter Marks, has resigned as head of the FDA's vaccine division, which oversees drug and food safety.

The New York Times and the Washington Post both reported the news. Marks described his move as a protest against "disinformation and lies" following the appointment of U.S. Secretary of Health and Human Services Robert F. Kennedy Jr.

In his resignation letter, he complained of "unprecedented attacks on scientific truth" by the secretary and his supporters.

According to US media reports, Marks may also have been pressured into resigning.

He probably had too little resistance

Política »  Nacional  Finanzas  Economía & Dinero  Salud  Familia & Juventud  Educación  Confederaciones  Trabajos & Social  Histórico  Otros  Políticos  Partidos  Privacidad & Cliente  Democracia

usatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressureimmunepotususatrumpintelligecehealthvaccinemarksfdadrugsdisinformationlieskennedyresistancemediapressure

Collections

(3)
Political Cartoons - International!
PRESIDENT DONALD TRUMP
U.S.A

comentarios (1)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, on 31 31+00:00 March 31+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: License to Kill (small) by KI-Vossy tagged ice,immigration,minnesota,jeffrey,pretti,nurse,trump,potus,usa,shot,fatal,minneapolis,fedral,police,tim,walz,schüsse,tödlich,dead,einwanderungsbehörde,eiwanderer,kill,killing,shooting
License to Kill
Cartoon: Grumpland (small) by KI-Vossy tagged whitehouse,politics,trump,usa,greenland,panama,canal,panamacanal,denmark,colianization,conqueror,grumpland,potus
Grumpland
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.