toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Bei Datteln und Feigen (medium) by KI-Vossy tagged frankreich,paris,eu,sarkozy,bruni,lybien,gaddafi,prozess,haftstrafe,gefängnis,wahlkampf,spenden,spendengelder,berufung,korruption,früchte,datteln,feigen,knast,frankreich,paris,eu,sarkozy,bruni,lybien,gaddafi,prozess,haftstrafe,gefängnis,wahlkampf,spenden,spendengelder,berufung,korruption,früchte,datteln,feigen,knast

Bei Datteln und Feigen

#471165 / vista 822 veces
KI-Vossy de KI-Vossy
on 25 25+00:00 September 25+00:00 2025
rating-star 6
Applause
favorite
Favorito
report spam
Denunciar

Frankreichs früherer Präsident Nicolas Sarkozy ist im Prozess um angebliche Wahlkampfgelder aus Libyen zu einer fünfjährigen Haftstrafe verurteilt worden. Er will in Berufung gehen: „Ich werde erhobenen Hauptes im Gefängnis schlafen“, sagte Sarkozy. Und wohl von libyschen Früchten träumen.

Política »  Nacional  Internacional  Elecciones  Finanzas  Economía & Dinero  Confederaciones  Fraude & Corrupción  Histórico  Otros  Políticos  Partidos  Democracia

frankreichpariseusarkozybrunilybiengaddafiprozesshaftstrafegefängniswahlkampfspendenspendengelderberufungkorruptionfrüchtedattelnfeigenknastfrankreichpariseusarkozybrunilybiengaddafiprozesshaftstrafegefängniswahlkampfspendenspendengelderberufungkorruptionfrüchtedattelnfeigenknast

Collections

(1)
Political Cartoons - International!

comentarios (2)

 
MorituruS
Member
Da beißt er auf des Lebens härtesten Dattelkern!

MorituruS, on 26 26+00:00 September 26+00:00 2025  reportar  contestar applause 0

 
ArtyFicial
Member
Bon appetit!

ArtyFicial, on 25 25+00:00 September 25+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Schwarzseher (small) by KI-Vossy tagged vodafone,gez,ard,zdf,örr,rundfunkbeitrag,verbraucherzentrale,kabelfernsehen,kabel,medien,dubai,nebenkostenprivilg,tv,signale,telekom,hausbesuch
Schwarzseher
Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: The perfect wave (small) by KI-Vossy tagged eisbär,eisbären,brasilien,klimaschutz,klimawandel,klimakonferenz,weltklimakonferenz,cop30,menschheit,klimaschutzziele,umwelt,un,klimakatastrophe,treibhausgase,schmelzen,gletscher,eisschmelze,arktis,antarktis,eisberg,eisberge,eiskappen,nordpol,südpol,polar,bear,bears,brazil,protection,climate,change,conference,world,humanity,goals,environment,catastrophe,greenhouse,gases,melting,glaciers,ice,melt,arctic,antarctic,iceberg,icebergs,caps
The perfect wave
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.