toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Wahlkampf-Startschuss (medium) by Mirco Tomicek tagged bundeskanzler,olaf,scholz,landtagswahl,wahl,wahlen,wahlkampf,bayern,fragen,bürger,spd,bundesliga,start,startschuss,anpfiff,münchen,werder,bremen,cartoon,karikatur,pressekarikatur,mirco,tomicek,bundeskanzler,olaf,scholz,landtagswahl,wahl,wahlen,wahlkampf,bayern,fragen,bürger,spd,bundesliga,start,startschuss,anpfiff,münchen,werder,bremen,cartoon,karikatur,pressekarikatur,mirco,tomicek

Wahlkampf-Startschuss

#429611 / vista 1575 veces
Mirco Tomicek de Mirco Tomicek
on 18 18+00:00 August 18+00:00 2023
rating-star 0
Applause
favorite
Favorito
report spam
Denunciar

Die Bundesliga startet in die neue Spielzeit. Knapp sechs Wochen vor der Landtagswahl in Bayern will sich Bundeskanzler Olaf Scholz den Fragen von Bürgern stellen.

Política »  Nacional  Elecciones  Familia & Juventud  Trabajos & Social  Otros  Políticos  Partidos  Privacidad & Cliente  Democracia

bundeskanzlerolafscholzlandtagswahlwahlwahlenwahlkampfbayernfragenbürgerspdbundesligastartstartschussanpfiffmünchenwerderbremencartoonkarikaturpressekarikaturmircotomicekbundeskanzlerolafscholzlandtagswahlwahlwahlenwahlkampfbayernfragenbürgerspdbundesligastartstartschussanpfiffmünchenwerderbremencartoonkarikaturpressekarikaturmircotomicek

comentarios (0)

añadir comentario  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de Mirco Tomicek


Cartoon: Virtuelle Realität (small) by Mirco Tomicek tagged portal,organe,organspende,organ,register,spender,spenden,spenderorgane,arzt,medizin,gesundheit,cartoon,karikatur,pressekarikatur,mirco,tomicek
Virtuelle Realität
Cartoon: Fit For Ostern (small) by Mirco Tomicek tagged ostern,ostereiersuche,eiersuche,eier,ostereier,suche,osterhase,hase,eiweißpulver,eiweiß,protein,fit,fitness,sport,gym,kraftsport,training,whey,proteine,cartoon,karikatur,pressekarikatur,mirco,tomicek
Fit For Ostern
Cartoon: Unions-Reformation (small) by Mirco Tomicek tagged bürger,geld,hartz,ampel,cdu,csu,union,friedrich,merz,bundesrat,gesetz,blockieren,reformation,reform,cartoon,karikatur,pressekarikatur,mirco,tomicek
Unions-Reformation
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.