toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Privacy data selling (medium) by Enrico Bertuccioli tagged data,tehcnology,socialmedia,dataselling,privacy,hitech,market,business,economy,money,political,exploitation,bigtech,corporations,consumerism,control,marketing,consumerdata,information,personaldata,security,protection,dataprotection,data,tehcnology,socialmedia,dataselling,privacy,hitech,market,business,economy,money,political,exploitation,bigtech,corporations,consumerism,control,marketing,consumerdata,information,personaldata,security,protection,dataprotection

Privacy data selling

#423855 / vista 1722 veces
Enrico Bertuccioli de Enrico Bertuccioli
on 19 19+00:00 April 19+00:00 2023
rating-star 1
Applause
favorite
Favorito
report spam
Denunciar

A really profitable market...

Negocio »  Managers  Empleo & Trabajo  Dinero & Créditos  Comercio & Venta  Ciclo Económico  Ordenador & Internet  Energía & Recursos  Comunicación  Crimen & Fraude  Ads & Marketing

datatehcnologysocialmediadatasellingprivacyhitechmarketbusinesseconomymoneypoliticalexploitationbigtechcorporationsconsumerismcontrolmarketingconsumerdatainformationpersonaldatasecurityprotectiondataprotectiondatatehcnologysocialmediadatasellingprivacyhitechmarketbusinesseconomymoneypoliticalexploitationbigtechcorporationsconsumerismcontrolmarketingconsumerdatainformationpersonaldatasecurityprotectiondataprotection

Collections

(1)
DAILY TOON COLLECTION

comentarios (2)

 
Enrico Bertuccioli
Member
Erl wrote:
Good one!

Many thanks Erl.

Enrico Bertuccioli, on 19 19+00:00 April 19+00:00 2023  reportar  contestar applause 0

 
Erl
Member
Good one!

Erl, on 19 19+00:00 April 19+00:00 2023  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de Enrico Bertuccioli


Cartoon: The crime scene (small) by Enrico Bertuccioli tagged peace,war,worldwar,peacedove,political,crime,humanbeings,weapons,warcrime,massdestruction,ukrainewar,russia,ukraine,global,crimescene,warcriminal
The crime scene
Cartoon: The claw of big tech (small) by Enrico Bertuccioli tagged world,newworldorder,technology,bigtech,technologicaldomain,domain,data,bigdata,power,control,neocapitalism,capitalism,technologicalcapitalism,digital,digitalcapitalism,money,business,economy,greed,dictatorship,political,politicalcartoon,editorialcartoon
The claw of big tech
Cartoon: COP26-the big game (small) by Enrico Bertuccioli tagged cop26,environment,climate,change,summit,political,global,planet,earth,conference,glasgow,italy,economy,power,money,united,nations,exploitation,ecology,investments,green,talks,meeting
COP26-the big game
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.