toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Patriot-System für Ukraine (medium) by leopold maurer tagged usa,ukraine,biden,selensky,besuch,patriot,abwehrsystem,waffen,weihnachtsmann,putin,krieg,geschenk,leopold,maurer,cartoon,karikatur,usa,ukraine,biden,selensky,besuch,patriot,abwehrsystem,waffen,weihnachtsmann,putin,krieg,geschenk,leopold,maurer,cartoon,karikatur

Patriot-System für Ukraine

#417498 / vista 1898 veces
leopold maurer de leopold maurer
on 21 21+00:00 December 21+00:00 2022
rating-star 7
Applause
favorite
Favorito
report spam
Denunciar

...

Política »  Nacional  Internacional  Elecciones  Ejército & Seguridad  Economía & Dinero  Conflictos & Guerra  Políticos  Partidos  Democracia  Energía

usaukrainebidenselenskybesuchpatriotabwehrsystemwaffenweihnachtsmannputinkrieggeschenkleopoldmaurercartoonkarikaturusaukrainebidenselenskybesuchpatriotabwehrsystemwaffenweihnachtsmannputinkrieggeschenkleopoldmaurercartoonkarikatur

Collections

(1)
Santa

comentarios (4)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, on 23 23+00:00 December 23+00:00 2022  reportar  contestar applause 0

 
Harm Bengen
Member
wir wollten uns doch dieses jahr nichts schenken.

Harm Bengen, on 21 21+00:00 December 21+00:00 2022  reportar  contestar applause 0

 
Erl
Member
Was so ein Schlitten alles tragen kann!!

Erl, on 21 21+00:00 December 21+00:00 2022  reportar  contestar applause 0

 
Barthold
Member
der schiefe Turm von Patriot

Barthold, on 21 21+00:00 December 21+00:00 2022  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de leopold maurer


Cartoon: 2G in Österreich (small) by leopold maurer tagged österreich,inzidenz,corona,covid,genesen,geimpft,test,pcr,antigen,frisör,gasthaus,theater,impfung,impfgegner,impfverweigerer,hospitalisiert,intensivstation,jodeln
2G in Österreich
Cartoon: Abschied von Merkel (small) by leopold maurer tagged merkel,abschied,bundeskanzlerin,pension,amt,projekte,digitalisierung,klimaschutz,versäumnisse
Abschied von Merkel
Cartoon: Warnstreiks (small) by leopold maurer tagged streik,arbeitsniederlegung,arbeitskampf,verdi,gewerkschaft,lohnerhöhung,bahn,verkehr,öffentlich,dienstgeber,arbeitnehmer,betroffene,zug,bus,flughafen,flüge,leopold,maurer,karikatur,cartoon
Warnstreiks
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.