toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Golden Dome over Greenland (medium) by KI-Vossy tagged potus,trump,usa,greenland,us,president,golden,dome,protection,missiles,defence,system,vital,denmark,control,territory,polar,bear,bears,polarbears,präsident,raketen,raketenabwehrsystem,grönland,dänemark,eisbär,eisbären,dänisch,potus,trump,usa,greenland,us,president,golden,dome,protection,missiles,defence,system,vital,denmark,control,territory,polar,bear,bears,polarbears,präsident,raketen,raketenabwehrsystem,grönland,dänemark,eisbär,eisbären,dänisch
página  1 2

Golden Dome over Greenland

#477619 / vista 544 veces
KI-Vossy de KI-Vossy
hace 3 semanas
rating-star 0
Applause
favorite
Favorito
report spam
Denunciar

US President Donald Trump has been touting ambitions to build a "Golden Dome" missile defence system since returning to office. Now the president says it is "vital" Greenland also has a Golden Dome, and the US should control the Danish territory to build it. Also to protect the endangered polar bears.

US-Präsident Donald Trump hat seit seiner Rückkehr ins Amt seine Ambitionen zum Bau eines Raketenabwehrsystems namens „Golden Dome“ bekundet. Nun erklärt der Präsident, es sei „von entscheidender Bedeutung“, dass auch Grönland über einen Golden Dome verfüge, und die USA sollten die Kontrolle über das dänische Territorium übernehmen, um diesen zu bauen. Auch zum Schutz der vom Aussterben bedrohten Eisbären.

Política »  Internacional  Ejército & Seguridad  Terrorismo  Economía & Dinero  Fraude & Corrupción  Histórico  Otros  Conflictos & Guerra  Políticos  Partidos  Democracia  Energía

potustrumpusagreenlanduspresidentgoldendomeprotectionmissilesdefencesystemvitaldenmarkcontrolterritorypolarbearbearspolarbearspräsidentraketenraketenabwehrsystemgrönlanddänemarkeisbäreisbärendänischpotustrumpusagreenlanduspresidentgoldendomeprotectionmissilesdefencesystemvitaldenmarkcontrolterritorypolarbearbearspolarbearspräsidentraketenraketenabwehrsystemgrönlanddänemarkeisbäreisbärendänisch

Collections

(2)
Political Cartoons - International!
PRESIDENT DONALD TRUMP

comentarios (0)

añadir comentario  
 

Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
Cartoon: Trumps B-day (small) by KI-Vossy tagged militärparade,washington,soldaten,panzer,parade,geburtstag,trump,usa,jubiläum,armee,friedensnobelpreis,soldiers,tanks,helicopters,birthday,party,army,putin,russia,korea,potus
Trumps B-day
Cartoon: Hell of a color (small) by KI-Vossy tagged trump,usa,skin,haut,gesichtshaut,orange,präsident,licht,energiesparlampen,glanz,bulbs,harris,heaven,origin,hell,potus
Hell of a color
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.