toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Free Nicolas! (medium) by KI-Vossy tagged frankreich,paris,nicolas,sarkozy,haft,frei,gefängnis,knast,justiz,berufung,freiheit,gericht,carla,bruni,president,francais,liberte,decide,tribunal,france,prison,release,free,freedom,appeal,supervision,aux,champs,elysees,frankreich,paris,nicolas,sarkozy,haft,frei,gefängnis,knast,justiz,berufung,freiheit,gericht,carla,bruni,president,francais,liberte,decide,tribunal,france,prison,release,free,freedom,appeal,supervision

Free Nicolas!

#473756 / vista 798 veces
KI-Vossy de KI-Vossy
on 10 10+00:00 November 10+00:00 2025
rating-star 3
Applause
favorite
Favorito
report spam
Denunciar

Nach drei Wochen Haft kommt Frankreichs früherer Präsident Nicolas Sarkozy wieder aus dem Gefängnis. Unter Justizaufsicht darf er den Ausgang eines Berufungsverfahrens in Freiheit abwarten, entschied ein Gericht in Paris. Wenn das kein Grund zu feiern ist?

Après trois semaines de détention, l'ancien président français Nicolas Sarkozy sort de prison. Sous contrôle judiciaire, il pourra attendre l'issue de la procédure d'appel en liberté, a décidé un tribunal de Paris. N'est-ce pas là une raison de se réjouir ?

After three weeks in prison, France's former president Nicolas Sarkozy is being released. A court in Paris has ruled that he may await the outcome of an appeal while under judicial supervision. If that's not a reason to celebrate ...

Política »  Nacional  Elecciones  Finanzas  Confederaciones  Trabajos & Social  Fraude & Corrupción  Histórico  Otros  Políticos  Partidos  Democracia

frankreichparisnicolassarkozyhaftfreigefängnisknastjustizberufungfreiheitgerichtcarlabrunipresidentfrancaislibertedecidetribunalfranceprisonreleasefreefreedomappealsupervisionauxchampselyseesfrankreichparisnicolassarkozyhaftfreigefängnisknastjustizberufungfreiheitgerichtcarlabrunipresidentfrancaislibertedecidetribunalfranceprisonreleasefreefreedomappealsupervision

comentarios (2)

 
Barthold
Member
Ende der Schnupper-Haft . . .

Barthold, on 12 12+00:00 November 12+00:00 2025  reportar  contestar applause 0

 
Shahid Atiq
Member
Excellent*****!

Shahid Atiq, on 11 11+00:00 November 11+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Unaussprechlich (small) by KI-Vossy tagged buchstaben,wales,ortsname,europa,urlaub,tld,domain,guiness,llanfair
Unaussprechlich
Cartoon: Schwarz Gelber Leopard (small) by KI-Vossy tagged karikaturist,karikatur,kikarikatur,kikatur,fußball,bvb,borussiadortmund,vereinsmakottchen,hansjoachimwatzke,rheinmetall,gerdmüller,fußballbundesliga,trikot,metaphern,bundesliga,leopard,schwarzgelb,panzer,ki,deutschland
Schwarz Gelber Leopard
Cartoon: Petri Heil (small) by KI-Vossy tagged angeln,fischen,berlin,angler,anglerlatein,fangfrage,bußgeld,netz,netze,fische,angelschein,eimer,reuse,witz,witzig,karikatur
Petri Heil
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.