toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Fischfamilie (medium) by wista tagged fisch,fische,familie,kind,kinder,viele,nachwuchs,schwarm,fischschwarm,interview,reporter,frage,fragen,kinderreich,kinderreichtum,nachkommen,eltern,vermehren,vermehrung,karnickel

Fischfamilie

#337437 / vista 4505 veces
wista de wista
on 06 06+00:00 June 06+00:00 2019
rating-star 1
Applause
favorite
Favorito
report spam
Denunciar

2019

Amor »  Matrimonio  Dating  Relación  Género  Sexo  Erotismo  Malentendidos  Boda  Familia  Suerte & Alegría  Soledad

fischfischefamiliekindkindervielenachwuchsschwarmfischschwarminterviewreporterfragefragenkinderreichkinderreichtumnachkommenelternvermehrenvermehrungkarnickel

comentarios (0)

añadir comentario  
 

Más de wista


Cartoon: hammerhart (small) by wista tagged hammer,nagel,nägel,werkzeug,werkzeuge,holz,brett,krumm,krumme,krummschlagen,werkzeugkiste,holzbau,schreiner,hobby,handwerker,handwerk,zange,säge,nageln,hämmern,einschlagen,do,it,yourself
hammerhart
Cartoon: drei Könige (small) by wista tagged heiligen,heilige,drei,könige,gold,weihrauch,myrrhe,geschenke,januar,dreikönig,dreikönigstag,könig,kaspar,melchior,balthasar,caspar
drei Könige
Cartoon: Nulldiät (small) by wista tagged nulldiät,diät,abnehmen,gewicht,gewichtsabnahme,essen,trinken,kalorien,waage,wunschgewicht,kilos,dick,dünn,ernährung,gesundheit,bmi,body,shaming,kohlenhydrate,zucker,protein,fett,fettsäuren
Nulldiät
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.