toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Eu China Gipfel (medium) by leopold maurer tagged eu,china,gipfel,peking,meeting,wirtschaft,ukraine,krieg,seltene,erden,elektro,autos,billigware,staatliche,unterstützung,handel,zölle,sanktionen,drache,stier,europa,leopold,maurer,karikatur,cartoon,eu,china,gipfel,peking,meeting,wirtschaft,ukraine,krieg,seltene,erden,elektro,autos,billigware,staatliche,unterstützung,handel,zölle,sanktionen,drache,stier,europa,leopold,maurer,karikatur,cartoon

Eu China Gipfel

#467758 / vista 751 veces
leopold maurer de leopold maurer
on 24 24+00:00 July 24+00:00 2025
rating-star 5
Applause
favorite
Favorito
report spam
Denunciar

...

Política »  Nacional  Internacional

euchinagipfelpekingmeetingwirtschaftukrainekriegselteneerdenelektroautosbilligwarestaatlicheunterstützunghandelzöllesanktionendrachestiereuropaleopoldmaurerkarikaturcartooneuchinagipfelpekingmeetingwirtschaftukrainekriegselteneerdenelektroautosbilligwarestaatlicheunterstützunghandelzöllesanktionendrachestiereuropaleopoldmaurerkarikaturcartoon

comentarios (3)

 
RABE
Member
Bares für Rares*****

RABE, on 28 28+00:00 July 28+00:00 2025  reportar  contestar applause 0

 
Erl
Member
Seltene Trotteln.

Erl, on 24 24+00:00 July 24+00:00 2025  reportar  contestar applause 0

 
Harm Bengen
Member
das rind?

Harm Bengen, on 24 24+00:00 July 24+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de leopold maurer


Cartoon: Proteine für die EU (small) by leopold maurer tagged eu,nobelpreis,chemie,entwicklung,protein,demokratie,autokratie,orban,ungarn,komission,ukraine,hilfe,putin,krieg,sanktionen,migration,asyl,ratsvorsitz,leopold,maurer,karikatur,cartoon
Proteine für die EU
Cartoon: Klimaziele (small) by leopold maurer tagged klimaziele,klimaschutz,verfehlen,hinterherhinken,kohle,gas,öl,fossile,kohleverbrennung,abgrund,weltklimakonferenz,leopold,maurer,karikatur,cartoon
Klimaziele
Cartoon: erdogan besucht putin (small) by leopold maurer tagged putin,erdogan,türkei,russland,konflikt,nordsyrien
erdogan besucht putin
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.