toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Das schaffen wir! (medium) by SoRei tagged merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme,optimismus,riss,in,der,gesellschaft,integration,asylpolitik,merkel,das,schaffen,wir,stammtisch,kneipe,stammtischpolitik,alkohol,rechtsstaatlichkeit,wohlstand,geister,flüchtlingswelle,flüchtlingskrise,asyldiskussion,asylrecht,bleiberecht,flucht,flüchtlingsschwemme

Das schaffen wir!

#257062 / vista 5597 veces
SoRei de SoRei
on 15 15+00:00 October 15+00:00 2015
rating-star 1
Applause
favorite
Favorito
report spam
Denunciar

Stammtischpolitik nervt mehr denn je.

Política »  Nacional  Internacional  Finanzas  Economía & Dinero  Inmigración  Otros  Conflictos & Guerra  Políticos  Democracia

merkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemmeoptimismusrissindergesellschaftintegrationasylpolitikmerkeldasschaffenwirstammtischkneipestammtischpolitikalkoholrechtsstaatlichkeitwohlstandgeisterflüchtlingswelleflüchtlingskriseasyldiskussionasylrechtbleiberechtfluchtflüchtlingsschwemme

comentarios (3)

 
Jenaerin
Member
Beides!

Jenaerin, on 27 27+00:00 September 27+00:00 2019  reportar  contestar applause 0

 
SoRei
Member
Doch. Ich schon!

SoRei, on 19 19+00:00 October 19+00:00 2015  reportar  contestar applause 0

 
JotKa
Member
:-))

JotKa, on 19 19+00:00 October 19+00:00 2015  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de SoRei


Cartoon: Horoskop (small) by SoRei tagged astrologie,esoterik,horoskop,auge,augen,einäugig,augenklappe,augenverband,augenklinik,augenheilkunde,aberglaube,irrglaube,kommunikation,verstehen,glauben,wundergläubig,interpretation,krankenhaus,krankenbett,galgen,nachttisch,tablett,besuch,täuschung,selbs
Horoskop
Cartoon: Frühling (small) by SoRei tagged virus,corona,mutation,mutant,hülle,keime,gene,ändern,viren,erbgut,dns,rns,zellen,infizieren,wirtszelle,proteine,erreger,nachkommen,reproduktionszyklus,immunsystem,erkennen,gendrift,genshift,enzyme,polymerasen,vervielfältigen,vermehren,kopieren,varianten,neu,kreation,flirt,anbaggern,anmachen,unmoralisches,angebot,sex,dating,special,interest,anzüglich,verführen,betören,eiweis,peptide,forschung,biologie,medizien,mikrokosmos,kommunikation,nachwuchs,gesundheit,symbiose,pandemie
Frühling
Cartoon: Follower (small) by SoRei tagged mode,fashion,victim,trendsetterin,influencerin,laufsteg,richkid,verbraucher,normalo,haute,couture,pret,porter,label,kollektion,konfektion,marke,style,modeschöpfer,tragen,oberbekleidung,maßgeschneidert,kombination,konsumieren,shoppen,beruf,werbung,werbeikone,designerin,luxusartikel,chique,schick,farben,stoffe,schnitte,präsenz,internet,realität,marketing,ansehen,soziale,netzwerke,hype,catwalk,gatekeeper,digital,analog,hashtag
Follower

  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon

  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies

  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate

  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2025 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data ( e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

Necessary Cookies: These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
Personalisation Cookies: These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
Convenience Cookies: These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
Analysis Cookies: These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.