toonpool logo
  • Agent
  • Collections
  • más
    • Community
    • Miembros
    • Búsqueda avanzada
    • Ayuda
  • Log In




    • Password lost?
  • Regístrate
  • español
    • english english
    • français français
    • deutsch deutsch
    • nederlands nederlands
    • español español
    • türkçe türkçe
    • Ελληνικά Ελληνικά
    • italiano italiano
▲
rightleftCartoons » más recientes viñetas
Cartoon: Black Epstein (medium) by KI-Vossy tagged trump,potus,president,usa,us,epstein,victim,victims,lawyer,scarola,department,justice,guidelines,publish,files,documents,offender,opferanwalt,justiz,justizministerium,kongress,opfer,geschwärzt,trump,potus,president,usa,us,epstein,victim,victims,lawyer,scarola,department,justice,guidelines,publish,files,documents,sex,offender,opferanwalt,justiz,justizministerium,kongress,opfer,geschwärzt

Black Epstein

#475879 / vista 448 veces
KI-Vossy de KI-Vossy
on 21 21+00:00 December 21+00:00 2025
rating-star 3
Applause
favorite
Favorito
report spam
Denunciar

From the perspective of victims' lawyer John Scarola, the US Department of Justice has disregarded congressional guidelines in publishing thousands of documents related to the Jeffrey Epstein case. The lawyer represents several victims of convicted sex offender Epstein. The publication of thousands more documents is expected in the coming weeks. Redacted.

Aus Sicht von Opferanwalt John Scarola hat das US-Justizministerium bei der Veröffentlichung Tausender Dokumente zum Fall Jeffrey Epstein die Vorgaben des Kongresses missachtet. Der Jurist vertritt mehrere Opfer des verurteilten Sexualstraftäters Epstein. In den nächsten Wochen wird die Publikation Tausender weiterer Dokumente erwartet. Geschwärzt.

Política »  Nacional  Internacional  Impuestos  Familia & Juventud  Fraude & Corrupción  Histórico  Otros  Políticos  Partidos  Privacidad & Cliente  Democracia

trumppotuspresidentusausepsteinvictimvictimslawyerscaroladepartmentjusticeguidelinespublishfilesdocumentsoffenderopferanwaltjustizjustizministeriumkongressopfergeschwärzttrumppotuspresidentusausepsteinvictimvictimslawyerscaroladepartmentjusticeguidelinespublishfilesdocumentssexoffenderopferanwaltjustizjustizministeriumkongressopfergeschwärzt

Collections

(3)
Political Cartoons - International!
PRESIDENT DONALD TRUMP
U.S.A

comentarios (1)

 
Enrico Bertuccioli
Member
Good one.

Enrico Bertuccioli, on 22 22+00:00 December 22+00:00 2025  reportar  contestar applause 0

 
 

añadir comentario
Dieses Motiv in Print & Web veröffentlichen »
  • Bezahlen per Anstrich
  • HighRes-Download sofort
  • täglich aktualisiert
Gleich ansehen »

Más de KI-Vossy


Cartoon: Yes it is .... (small) by KI-Vossy tagged halloween,pumpkin,pumpkins,wien,der,dritte,mann,film,celebration,celebrations,kürbis,kürbisse,prater,riesenrad,austria,österreich,vienna,night,nacht,kalauer
Yes it is ....
Cartoon: Clown Troll (small) by KI-Vossy tagged zollkrieg,handelskrieg,usa,china,trump,drogenschmuggel,fentanyl,krieg,handel,loser,award,tariff,time,potus
Clown Troll
Cartoon: Don the Decorator (small) by KI-Vossy tagged republikaner,hakenkreuz,taylor,flagge,usa,washington,trump,republicans,meeting,flag,us,swastika,motif,republican,cross,right,wing,politiker,weiße,haus,decoration,decorations,decorator,paint,brown,potus
Don the Decorator
  • Service

  • ToonAgent
  • ayuda
  • FAQ
  • Daily Toon
  • Sobre la empresa

  • Sobre la empresa
  • Contacto
  • Condiciones de uso
  • Política de privacidad
  • Manage cookies
  • Community

  • Community
  • Búsqueda avanzada
  • Collections
  • Regístrate
  • Social

  • Blog
  • facebook
  • RSS-Feed
  • twitter
Copyright © 2007-2026 toonpool.com GmbH
Cookie-Einstellungen

We use cookies and similar technologies on our website. Some of them are essential, while others support us by enhancing the website and user experience. Personal data (e.g. IP addresses) could be processed, e.g. for personalized ads and content or user metrics. Further information about the usage of your data can be found in our Privacy Policy. You can edit or revoke your choice anytime by clicking on the "Manage cookies" link in the footer of any page.

These cookies and similar technologies are needed in order to provide the usual functionality of our website and can’t be deactivated in our system.
These cookies and similar technologies may be set by our advertising partner Google AdSense in order to build a profile of your interests and show you relevant advertisements on other sites. If you do not allow this option, you will experience less targeted advertising.
These cookies and similar technologies are used to provide a most comfortable user experience, e.g. saving data about your position in the actual image gallery. This data is used only on the server which hosts the website.
These cookies and similar technologies are used to retrieve statistical information about our website. They help us to know how visitors use the site, which helps us optimize your experience. We use Google Analytics and Google Tag Manager for this purpose.